Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPD Rabbit pAb (APR17827N)

Product Specifications

Background

The metallocarboxypeptidase family of enzymes is divided into 2 subfamilies based on sequence similarities. The pancreatic carboxypeptidase-like and the regulatory B-type carboxypeptidase subfamilies. Carboxypeptidase D has been identified as a regulatory B-type carboxypeptidase. CPD is a homolog of duck gp180, a hepatitis B virus-binding protein. Transcript variants utilizing alternative polyadenylation signals exist for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CPD Rabbit pAb (APR17818N8) .

Synonyms

CPD; GP180

Gene ID

1362

UniProt

O75976

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 126kDa/152kDa Observed MW: 200kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1362

Uniprot URL

https://www.uniprot.org/uniprot/O75976

AA Sequence

SEGAIQVNFTLVRSSTDSNNESKKGKGASSSTNDASDPTTKEFETLIKDLSAENGLESLMLRSSSNLALALYRYHSYKDLSEFLRGLVMNYPHITNLTNLGQSTEYRHIWSLEISNKPNVSEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPAVTQLVDRTRIVIVPSLNPDGRERAQEKDCTSKIGQTNARGKDLDTDFTNNASQPETKAIIENLIQKQDFSLSVALDGGSM

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human GSK-3 beta ELISA Kit (Colorimetric)
NBP3-31818 1 Kit

Human GSK-3 beta ELISA Kit (Colorimetric)

Ask
View Details
SURF5 (MED22, Mediator of RNA Polymerase II Transcription Subunit 22, Mediator Complex Subunit 22, Surfeit Locus Protein 5, Surf-5, MGC48682) (AP)
MBS6134076-01 0.1 mL

SURF5 (MED22, Mediator of RNA Polymerase II Transcription Subunit 22, Mediator Complex Subunit 22, Surfeit Locus Protein 5, Surf-5, MGC48682) (AP)

Ask
View Details
SURF5 (MED22, Mediator of RNA Polymerase II Transcription Subunit 22, Mediator Complex Subunit 22, Surfeit Locus Protein 5, Surf-5, MGC48682) (AP)
MBS6134076-02 5x 0.1 mL

SURF5 (MED22, Mediator of RNA Polymerase II Transcription Subunit 22, Mediator Complex Subunit 22, Surfeit Locus Protein 5, Surf-5, MGC48682) (AP)

Ask
View Details
Commd6 (NM_001109105) Rat Tagged ORF Clone
RR207337 10 µg

Commd6 (NM_001109105) Rat Tagged ORF Clone

Ask
View Details
Lentiviral mouse Aqp9 shRNA (UAS) - Lentiviral mouse Aqp9 shRNA (UAS, GFP) (100)
GTR15230217 1 Vial

Lentiviral mouse Aqp9 shRNA (UAS) - Lentiviral mouse Aqp9 shRNA (UAS, GFP) (100)

Ask
View Details
Ferritin (Ferritin H Subunit, Ferritin Heavy Chain, FHC, FTH, Ferritin Heavy Polypeptide 1, FTH1, Ferritin L Subunit, Ferritin Light Chain, Ferritin Light Polypeptide, FTL, Cell Proliferation-inducing Gene 15 Protein, FTHL6, MGC71996, MGC104426, OK/SW-cl.84, PIG15, PLIF) discontinued
F4015-04Y 1 mg

Ferritin (Ferritin H Subunit, Ferritin Heavy Chain, FHC, FTH, Ferritin Heavy Polypeptide 1, FTH1, Ferritin L Subunit, Ferritin Light Chain, Ferritin Light Polypeptide, FTL, Cell Proliferation-inducing Gene 15 Protein, FTHL6, MGC71996, MGC104426, OK/SW-cl.84, PIG15, PLIF) discontinued

Ask
View Details