Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP6 Rabbit pAb (APR17815N)

Product Specifications

Background

The superfamily of insulin-like growth factor (IGF) binding proteins include the six high-affinity IGF binding proteins (IGFBP) and at least four additional low-affinity binding proteins referred to as IGFBP related proteins (IGFBP-rP) . All IGFBP superfamily members are cysteine-rich proteins with conserved cysteine residues, they can bind IGF-I and IGF-II with the equal affinity. Insulin-like growth factor (IGF) binding proteins (IGFBPs) have been shown to either inhibit or enhance the action of IGF, or act in an IGF-independent manner in the prostate. IGF-binding protein-4 (IGFBP-4) inhibits IGF-I action in vitro and is the most abundant IGFBP in the rodent arterial wall. IGFBP6 is directly downregulated by the beta-catenin/TCF complex in desmoid tumors, and imply a role for the IGF axis in the proliferation of desmoid tumors. There is mounting evidence that the structure of the IGFBP proteins plays a key role in the regulation of IGF bioavailability, by modulating its molecular size, capillary membrane permeability, target tissue specificity, cell membrane adherence and IGF affinity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IGFBP6 Rabbit pAb (APR17809N5) .

Synonyms

IGFBP6; IBP6

Gene ID

3489

UniProt

P24592

Cellular Locus

Secreted

Dilution

WB 1:1000 - 1:3000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3489

Uniprot URL

https://www.uniprot.org/uniprot/P24592

AA Sequence

RCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal IL-32 Antibody (034) [CoraFluor 1]
NBP2-89776CL1 0.1 mL

Rabbit Monoclonal IL-32 Antibody (034) [CoraFluor 1]

Sign In for Pricing
View Details
Recombinant Horse Follicle-stimulating hormone receptor (FSHR)
orb2903507-01 20 µg

Recombinant Horse Follicle-stimulating hormone receptor (FSHR)

Sign In for Pricing
View Details
Recombinant Horse Follicle-stimulating hormone receptor (FSHR)
orb2903507-02 100 µg

Recombinant Horse Follicle-stimulating hormone receptor (FSHR)

Sign In for Pricing
View Details
Treble Frame Set 05 in White with Purple Trays - EACH
SED1022B 1 Each

Treble Frame Set 05 in White with Purple Trays - EACH

Sign In for Pricing
View Details
IP6K3 Antibody
42-179 0.1 mg

IP6K3 Antibody

Sign In for Pricing
View Details
Metabotropic Glutamate Receptor 6 (GRM6) (NM_000843) Human Over-expression Lysate
LH03089V 100 µg

Metabotropic Glutamate Receptor 6 (GRM6) (NM_000843) Human Over-expression Lysate

Sign In for Pricing
View Details