Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX6 Rabbit pAb (APR17761N)

Product Specifications

Background

The protein encoded by this gene belongs to the family of P2X receptors, which are ATP-gated ion channels and mediate rapid and selective permeability to cations. This gene is predominantly expressed in skeletal muscle, and regulated by p53. The encoded protein is associated with VE-cadherin at the adherens junctions of human umbilical vein endothelial cells. Alternative splicing results in multiple transcript variants. A related pseudogene, which is also located on chromosome 22, has been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality P2RX6 Rabbit pAb (APR17761N) .

Synonyms

P2RX6; P2RXL1; P2X6; P2XM

Gene ID

9127

UniProt

O15547

Cellular Locus

Membrane, Multi-pass membrane protein

Dilution

WB 1:200 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 45kDa/48kDa Observed MW: 49kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9127

Uniprot URL

https://www.uniprot.org/uniprot/O15547

AA Sequence

WGLLDYKTEKWALLAKKGYQERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTNFLVTPAQVQGRCPEHPSVPLANCWVDEDCPEGEGGTHSHGVKTGQCVVFNGTHRTCEIWSWCPVESGVVPSRPLLAQAQNFTLFIKNTVTFSKFNFSKSNALETWDPTYFKHCRYEPQFSPYCPVFRIGDLVAKAGGTFEDLALLGGSVGIRVHWDCDLDTGDSGCWPHYSFQLQEKSYNFRTATHWWEQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA Tag (16.43), 0.2mg/mL
BNUB2543-500 1x 500 µL

HA Tag (16.43), 0.2mg/mL

Sign In for Pricing
View Details
Thebaol Acetate
TRC-T342530-25MG 25 mg

Thebaol Acetate

Sign In for Pricing
View Details
mLH1 Human Gene Knockout Kit (CRISPR)
KN201607 1 Kit

mLH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Ankrd53 activation kit by CRISPRa
GA210165 1 Kit

Mouse Ankrd53 activation kit by CRISPRa

Sign In for Pricing
View Details
PLEKHA2 Human Gene Knockout Kit (CRISPR)
KN418830 1 Kit

PLEKHA2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5HT3A receptor (HTR3A) Human Gene Knockout Kit (CRISPR)
KN401342 1 Kit

5HT3A receptor (HTR3A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details