Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD53 Rabbit pAb (APR17715N)

Product Specifications

Background

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It contributes to the transduction of CD2-generated signals in T cells and natural killer cells and has been suggested to play a role in growth regulation. Familial deficiency of this gene has been linked to an immunodeficiency associated with recurrent infectious diseases caused by bacteria, fungi and viruses. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD53 Rabbit pAb (APR17705N9) .

Synonyms

CD53; MOX44; TSPAN25

Gene ID

963

UniProt

P19397

Cellular Locus

Cell junction, Cell membrane, Membrane, Multi-pass membrane protein

Dilution

WB 1:1000 - 1:4000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=963

Uniprot URL

https://www.uniprot.org/uniprot/P19397

AA Sequence

AILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2',4'-Difluoro-4-hydroxy-[1,1'-biphenyl]-3-carboxaldehyde-d3
TRC-D447367-5MG 5 mg

2',4'-Difluoro-4-hydroxy-[1,1'-biphenyl]-3-carboxaldehyde-d3

Sign In for Pricing
View Details
N-Cbz-O-Bzl-L-Glu-S-Bzl-L-Cys-Gly[13C2,15N]-OBzl
TRC-C215102-1MG 1 mg

N-Cbz-O-Bzl-L-Glu-S-Bzl-L-Cys-Gly[13C2,15N]-OBzl

Sign In for Pricing
View Details
NextPette™ variable volume pipette 2 to 20ul
P7700-20 1 Each

NextPette™ variable volume pipette 2 to 20ul

Sign In for Pricing
View Details
Phospho-Syk (Y525 + Y526) Recombinant Rabbit monoclonal Antibody
HA750904 100 µL

Phospho-Syk (Y525 + Y526) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD33 Recombinant Rabbit monoclonal Antibody
HA750814 100 µL

CD33 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human C1orf53 activation kit by CRISPRa
GA117993 1 Kit

Human C1orf53 activation kit by CRISPRa

Sign In for Pricing
View Details