Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY75 Rabbit pAb (APR17700N)

Product Specifications

Background

Acts as an endocytic receptor to direct captured antigens from the extracellular space to a specialized antigen-processing compartment (By similarity. Causes reduced proliferation of B-lymphocytes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LY75 Rabbit pAb (APR17700N) .

Synonyms

LY75; CD205; CLEC13B; DEC-205; GP200-MR6; LY-75

Gene ID

4065

UniProt

O60449

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/26kDa/198kDa/209kDa/215kDa Observed MW: 205kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4065

Uniprot URL

https://www.uniprot.org/uniprot/O60449

AA Sequence

TEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEKLKYVCKRKGEKLNDASSDKMCPPDEGWKRHGETCYKIYEDEVPFGTNCNLTITSRFEQEYLNDLMKKYDKSLRKYFWTGLRDVDSCGEYNWATVGGRRRAVTFSNWNFLEPASPGGCVAMSTGKSVGKWEVKDCRSFKALSICKKMSGPLGPEEASPKPDDPCPEGWQSFPASLSCYKVFHAERIVRKRNWEEAERFCQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MC1 Receptor Mouse mAb
A11803 200 µL

MC1 Receptor Mouse mAb

Sign In for Pricing
View Details
BMP3 ORF Vector (Human) (pORF)
13366011 1.0 µg DNA

BMP3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SLAMF1 Human Pre-designed siRNA Set A
HY-RS12979 1 Set

SLAMF1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Polyclonal PTP gamma/PTPRG Antibody
NBP2-57477-25ul 25 µL

Rabbit Polyclonal PTP gamma/PTPRG Antibody

Sign In for Pricing
View Details
Collagen Type IV alpha 3 antibody
70R-5733 100 µL

Collagen Type IV alpha 3 antibody

Sign In for Pricing
View Details
UNC45B, NT (UNC45B, CMYA4, UNC45, Protein unc-45 homolog B, SMUNC45)
MBS6012438-01 0.2 mL

UNC45B, NT (UNC45B, CMYA4, UNC45, Protein unc-45 homolog B, SMUNC45)

Sign In for Pricing
View Details