Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DSC1 Rabbit pAb (APR17696N)

Product Specifications

Background

The protein encoded by this gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation. A subtype of IgA pemphigus, a life-threatening autoimmune disease, is characterized by the presence of autoantibodies that target the encoded protein. The desmosomal family members are arranged in two clusters on chromosome 18. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate the mature protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DSC1 Rabbit pAb (APR17696N) .

Synonyms

DSC1; CDHF1; DG2/DG3

Gene ID

1823

UniProt

Q08554

Cellular Locus

Cell junction, Cell membrane, Single-pass type I membrane protein, desmosome

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 93kDa/99kDa Observed MW: 100KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1823

Uniprot URL

https://www.uniprot.org/uniprot/Q08554

AA Sequence

SQDGFPAGQELLGYKALDPEISSGEGLRYQKLGDEDNWFEINQHTGDLRTLKVLDRESKFVKNNQYNISVVAVDAVGRSCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTRDVRPNVILG

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NFkB, p100/p52 (Nuclear Factor NF-kappa-B p100 Subunit, DNA-binding Factor KBF2, H2TF1, Lymphocyte Translocation Chromosome 10 Protein, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 2, Oncogene Lyt-10, Lyt10, Nuclear Factor NF-kappa-B p52 Subunit, NFKB2, LYT10) discontinued
N2305-02H-01 50 µg

NFkB, p100/p52 (Nuclear Factor NF-kappa-B p100 Subunit, DNA-binding Factor KBF2, H2TF1, Lymphocyte Translocation Chromosome 10 Protein, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 2, Oncogene Lyt-10, Lyt10, Nuclear Factor NF-kappa-B p52 Subunit, NFKB2, LYT10) discontinued

Ask
View Details
NFkB, p100/p52 (Nuclear Factor NF-kappa-B p100 Subunit, DNA-binding Factor KBF2, H2TF1, Lymphocyte Translocation Chromosome 10 Protein, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 2, Oncogene Lyt-10, Lyt10, Nuclear Factor NF-kappa-B p52 Subunit, NFKB2, LYT10) discontinued
N2305-02H-02 100 µg

NFkB, p100/p52 (Nuclear Factor NF-kappa-B p100 Subunit, DNA-binding Factor KBF2, H2TF1, Lymphocyte Translocation Chromosome 10 Protein, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 2, Oncogene Lyt-10, Lyt10, Nuclear Factor NF-kappa-B p52 Subunit, NFKB2, LYT10) discontinued

Ask
View Details
Rabbit Monoclonal Carbonic Anhydrase XIV/CA14 Antibody (110) [Alexa Fluor 647]
NBP2-89509AF647 0.1 mL

Rabbit Monoclonal Carbonic Anhydrase XIV/CA14 Antibody (110) [Alexa Fluor 647]

Ask
View Details
Mouse Cell surface glycoprotein MUC18 (MCAM) Elisa Kit
EK731266 96 Well

Mouse Cell surface glycoprotein MUC18 (MCAM) Elisa Kit

Ask
View Details
GNE 477
MBS578553 Inquire

GNE 477

Ask
View Details
NRBP2 (Nuclear Receptor Binding Protein 2, DKFZp434P086, MGC138699, TRG16, pp9320) (MaxLight 490)
MBS6207682-01 0.1 mL

NRBP2 (Nuclear Receptor Binding Protein 2, DKFZp434P086, MGC138699, TRG16, pp9320) (MaxLight 490)

Ask
View Details