Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD35/CR1 Rabbit pAb (APR17694N)

Product Specifications

Background

This gene is a member of the receptors of complement activation (RCA) family and is located in the 'cluster RCA' region of chromosome 1. The gene encodes a monomeric single-pass type I membrane glycoprotein found on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells. The Knops blood group system is a system of antigens located on this protein. The protein mediates cellular binding to particles and immune complexes that have activated complement. Decreases in expression of this protein and/or mutations in its gene have been associated with gallbladder carcinomas, mesangiocapillary glomerulonephritis, systemic lupus erythematosus and sarcoidosis. Mutations in this gene have also been associated with a reduction in Plasmodium falciparum rosetting, conferring protection against severe malaria. Alternate allele-specific splice variants, encoding different isoforms, have been characterized. Additional allele specific isoforms, including a secreted form, have been described but have not been fully characterized.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD35/CR1 Rabbit pAb (APR17694N) .

Synonyms

CR1; C3BR; C4BR; CD35; KN

Gene ID

1378

UniProt

P17927

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 223kDa Observed MW: 270kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1378

Uniprot URL

https://www.uniprot.org/uniprot/P17927

AA Sequence

FCPSPPVIPNGRHTGKPLEVFPFGKTVNYTCDPHPDRGTSFDLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MAT1A
P1723-01 50 µg

Recombinant Human MAT1A

Sign In for Pricing
View Details
Recombinant Human MAT1A
P1723-02 200 µg

Recombinant Human MAT1A

Sign In for Pricing
View Details
Recombinant Human MAT1A
P1723-03 1 mg

Recombinant Human MAT1A

Sign In for Pricing
View Details
SSX1 AAV siRNA Pooled Vector
45570161 1.0 µg

SSX1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
OAEC01416-100UG - Syk (Ab-323) Antibody
OAEC01416-100UG 100 µg

OAEC01416-100UG - Syk (Ab-323) Antibody

Sign In for Pricing
View Details
MYH3 (F1.652) Alexa Fluor® 680
sc-53091 AF680 200 µg/mL

MYH3 (F1.652) Alexa Fluor® 680

Sign In for Pricing
View Details