Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU2F3 Rabbit pAb (APR17689N)

Product Specifications

Background

This gene encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein is primarily expressed in the epidermis, and plays a critical role in keratinocyte proliferation and differentiation. The encoded protein is also a candidate tumor suppressor protein, and aberrant promoter methylation of this gene may play a role in cervical cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality POU2F3 Rabbit pAb (APR17689N) .

Synonyms

POU2F3; Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a

Gene ID

25833

UniProt

Q9UKI9

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 46kDa/47kDa Observed MW: 47kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=25833

Uniprot URL

https://www.uniprot.org/uniprot/Q9UKI9

AA Sequence

MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPGQQGLQPNLLPFPQQQSGLLLPQTGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Testisin/Prss21 CF
6820-SE-010 10 µg

Recombinant Mouse Testisin/Prss21 CF

Sign In for Pricing
View Details
FAM75A5 sgRNA CRISPR Lentivector (Human) (Target 1)
K0731002 1.0 µg DNA

FAM75A5 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PITX3 Antibody (HRP)
orb45911-01 50 µg

PITX3 Antibody (HRP)

Sign In for Pricing
View Details
PITX3 Antibody (HRP)
orb45911-02 100 µg

PITX3 Antibody (HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal STAG3 Antibody
NBP3-11926-25ug 25 µg

Rabbit Polyclonal STAG3 Antibody

Sign In for Pricing
View Details
3-Amino-6- (2,3-dichlorophenyl) -1,2,4-triazin-5 (2H) -one
OR1102447-01 100 mg

3-Amino-6- (2,3-dichlorophenyl) -1,2,4-triazin-5 (2H) -one

Sign In for Pricing
View Details