Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPC1L1 Rabbit pAb (APR17684N)

Product Specifications

Background

The protein encoded by this gene is a multi-pass membrane protein. It contains a conserved N-terminal Niemann-Pick C1 (NPC1) domain and a putative sterol-sensing domain (SSD) which includes a YQRL motif functioning as a plasma membrane to trans-Golgi network transport signal in other proteins. This protein takes up free cholesterol into cells through vesicular endocytosis and plays a critical role in the absorption of intestinal cholesterol. It also has the ability to transport alpha-tocopherol (vitamin E) . The drug ezetimibe targets this protein and inhibits the absorption of intestinal cholesterol and alpha-tocopherol. In addition, this protein may play a critical role in regulating lipid metabolism. Polymorphic variations in this gene are associated with plasma total cholesterol and low-density lipoprotein cholesterol (LDL-C) levels and coronary heart disease (CHD) risk. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NPC1L1 Rabbit pAb (APR17684N) .

Synonyms

NPC1L1; NPC11L1

Gene ID

29881

UniProt

Q9UHC9

Cellular Locus

Apical cell membrane, Cell membrane, Cytoplasmic vesicle membrane, Multi-pass membrane protein

Dilution

WB 1:1000 - 1:4000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 79kDa/140kDa/145kDa/148kDa Observed MW: 148kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29881

Uniprot URL

https://www.uniprot.org/uniprot/Q9UHC9

AA Sequence

AAYSTSVNLTSDGQVLASRFMAYHKPLKNSQDYTEALRAARELAANITADLRKVPGTDPAFEVFPYTITNV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC17A4 Human Pre-designed siRNA Set A
HY-RS13037 1 Set

SLC17A4 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rat Abca12 Pre-designed siRNA Set B
SI200028B 1 Each

Rat Abca12 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Myg1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV683733 1.0 µg DNA

Myg1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
APOA4 Antibody
A12875-100UL 100 µL

APOA4 Antibody

Sign In for Pricing
View Details
FAM177B (NM_207468) Human Tagged Lenti ORF Clone
RC212603L4 10 µg

FAM177B (NM_207468) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Gm20747 Mouse shRNA Plasmid (Locus ID 434960)
TR508840 1 Kit

Gm20747 Mouse shRNA Plasmid (Locus ID 434960)

Sign In for Pricing
View Details