Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPHOSPH10 Rabbit pAb (APR17677N)

Product Specifications

Background

This gene encodes a protein that is phosphorylated during mitosis. The protein localizes to the nucleolus during interphase and to the chromosomes during M phase. The protein associates with the U3 small nucleolar ribonucleoprotein 60-80S complexes and may be involved in pre-rRNA processing.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MPHOSPH10 Rabbit pAb (APR17677N) .

Synonyms

MPHOSPH10; CT90; MPP10; MPP10P; PPP1R106

Gene ID

10199

UniProt

O00566

Cellular Locus

Chromosome, Nucleus, nucleolus

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 78kDa Observed MW: 78kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10199

Uniprot URL

https://www.uniprot.org/uniprot/O00566

AA Sequence

RIRDQAWDDVVRKEKPKEDAYEYKKRLTLDHEKSKLSLAEIYEQEYIKLNQQKTAEEENPEHVEIQKMMDSLFLKLDALSNFHFIPKPPVPEIKVVSNLPAITMEEVAPVSVSDAALLAPEEIKEKNKAGDIKTAAEKTATDKKRERRKKKYQKRMKIKEKEKRRKLLEKSSVDQAGKYSKTVASEKLKQLTKTGKASFIKDEGKDKALKSSQAFFSKLQDQVKMQINDAKKTEKKKKKRQDISVHKLKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Human Lactoferrin Antibody
orb1519253 1 mg

Rabbit Human Lactoferrin Antibody

Sign In for Pricing
View Details
6-Arm-PEG-FA (MW 600)
HY-174960A 1 Each

6-Arm-PEG-FA (MW 600)

Sign In for Pricing
View Details
Recombinant Drosophila persimilis Protein quiver (qvr)
MBS1032763-01 0.02 mg (E-Coli)

Recombinant Drosophila persimilis Protein quiver (qvr)

Sign In for Pricing
View Details
Recombinant Drosophila persimilis Protein quiver (qvr)
MBS1032763-02 0.1 mg (E-Coli)

Recombinant Drosophila persimilis Protein quiver (qvr)

Sign In for Pricing
View Details
Recombinant Drosophila persimilis Protein quiver (qvr)
MBS1032763-03 0.02 mg (Yeast)

Recombinant Drosophila persimilis Protein quiver (qvr)

Sign In for Pricing
View Details
Recombinant Drosophila persimilis Protein quiver (qvr)
MBS1032763-04 0.1 mg (Yeast)

Recombinant Drosophila persimilis Protein quiver (qvr)

Sign In for Pricing
View Details