What is the catalog number for HBS1L Rabbit pAb (APR17672N)?

The catalog number for HBS1L Rabbit pAb (APR17672N) is APR17672N.

What sizes are available for HBS1L Rabbit pAb (APR17672N)?

HBS1L Rabbit pAb (APR17672N) is available in the following size(s): 50 µL, 100 µL, 200 µL.

How many pack sizes does HBS1L Rabbit pAb (APR17672N) come in?

HBS1L Rabbit pAb (APR17672N) is available in 3 different pack sizes.

Is HBS1L Rabbit pAb (APR17672N) in stock?

HBS1L Rabbit pAb (APR17672N) is currently made to order / not held in immediate stock. Contact us for lead time.

HBS1L Rabbit pAb (APR17672N)

Product Specifications

Background

This gene encodes a member of the GTP-binding elongation factor family. It is expressed in multiple tissues with the highest expression in heart and skeletal muscle. The intergenic region of this gene and the MYB gene has been identified to be a quantitative trait locus (QTL) controlling fetal hemoglobin level, and this region influnces erythrocyte, platelet, and monocyte counts as well as erythrocyte volume and hemoglobin content. DNA polymorphisms at this region associate with fetal hemoglobin levels and pain crises in sickle cell disease. A single nucleotide polymorphism in exon 1 of this gene is significantly associated with severity in beta-thalassemia/Hemoglobin E. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HBS1L Rabbit pAb (APR17672N) .

Synonyms

HBS1L; EF-1a; ERFS; HBS1; HSPC276; eRF3c

Gene ID

10767

UniProt

Q9Y450

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 70kDa/75kDa Observed MW: 75kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10767

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y450

AA Sequence

MARHRNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDKPSVEPVEEYDYEDLKESSNSVSNHQLSGFDQARLYSCLDHMREVLGDAVPDEILIEAVLKNKFDVQKALSGVLEQDRVQSLKDKNEATVSTGKIAKGKPVDSQTSRSESEIVPKVAKMTVSGKKQTMGFEVPGVSSEENGHSFHTPQKGPPIEDAIASSDVLETASKSANPPHTIQASEEQSSTPAPVKKSGKLRQQIDVKAELEKRQGGKQL