Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBS1L Rabbit pAb (APR17672N)

Product Specifications

Background

This gene encodes a member of the GTP-binding elongation factor family. It is expressed in multiple tissues with the highest expression in heart and skeletal muscle. The intergenic region of this gene and the MYB gene has been identified to be a quantitative trait locus (QTL) controlling fetal hemoglobin level, and this region influnces erythrocyte, platelet, and monocyte counts as well as erythrocyte volume and hemoglobin content. DNA polymorphisms at this region associate with fetal hemoglobin levels and pain crises in sickle cell disease. A single nucleotide polymorphism in exon 1 of this gene is significantly associated with severity in beta-thalassemia/Hemoglobin E. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HBS1L Rabbit pAb (APR17672N) .

Synonyms

HBS1L; EF-1a; ERFS; HBS1; HSPC276; eRF3c

Gene ID

10767

UniProt

Q9Y450

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 70kDa/75kDa Observed MW: 75kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10767

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y450

AA Sequence

MARHRNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDKPSVEPVEEYDYEDLKESSNSVSNHQLSGFDQARLYSCLDHMREVLGDAVPDEILIEAVLKNKFDVQKALSGVLEQDRVQSLKDKNEATVSTGKIAKGKPVDSQTSRSESEIVPKVAKMTVSGKKQTMGFEVPGVSSEENGHSFHTPQKGPPIEDAIASSDVLETASKSANPPHTIQASEEQSSTPAPVKKSGKLRQQIDVKAELEKRQGGKQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orforglipron Impurity 32
RM-O493032-01 10 mg

Orforglipron Impurity 32

Sign In for Pricing
View Details
Orforglipron Impurity 32
RM-O493032-02 100 mg

Orforglipron Impurity 32

Sign In for Pricing
View Details
Orforglipron Impurity 32
RM-O493032-03 25 mg

Orforglipron Impurity 32

Sign In for Pricing
View Details
Orforglipron Impurity 32
RM-O493032-04 50 mg

Orforglipron Impurity 32

Sign In for Pricing
View Details
NEURL2 (1-285, His-tag) Human Protein
AR51121PU-N 250 µg

NEURL2 (1-285, His-tag) Human Protein

Sign In for Pricing
View Details
Mouse Collagen Type II ELISA Kit
ELA-E0572m 96 Tests

Mouse Collagen Type II ELISA Kit

Sign In for Pricing
View Details