CYP3A7 Rabbit pAb (APR17661N)
Product Specifications
Background
This gene encodes a member of the cytochrome P450 superfamily of enzymes, which participate in drug metabolism and the synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. This gene is part of a cluster of related genes on chromosome 7q21.1. Naturally-occurring readthrough transcription occurs between this gene and the downstream CYP3A51P pseudogene and is represented by GeneID:100861540.
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CYP3A7 Rabbit pAb (APR17661N) .
Synonyms
CYP3A7; CP37; CYPIIIA7; P-450 (HFL33) ; P-450111A7; P450-HFLA
Gene ID
1551
UniProt
P24462
Cellular Locus
Endoplasmic reticulum membrane, Microsome membrane, Peripheral membrane protein
Dilution
WB 1:500 - 1:2000 IF 1:50 - 1:200
Form
Liquid
Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Molecular Weight
Calculated MW: 57kDa/61kDa Observed MW: 75kDa
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Gene ID URL
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1551
Uniprot URL
https://www.uniprot.org/uniprot/P24462
AA Sequence
KVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSGA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041576-500 1x 500 µL
Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402151-100 1x 100 µL
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details