Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNG1 Rabbit pAb (APR17648N)

Product Specifications

Background

Voltage-dependent calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of two known gamma subunit proteins. This particular gamma subunit is part of skeletal muscle 1,4-dihydropyridine-sensitive calcium channels and is an integral membrane protein that plays a role in excitation-contraction coupling. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members that function as transmembrane AMPA receptor regulatory proteins (TARPs) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CACNG1 Rabbit pAb (APR17648N) .

Synonyms

CACNG1; CACNLG

Gene ID

786

UniProt

Q06432

Cellular Locus

Membrane, Multi-pass membrane protein

Dilution

WB 1:1000 - 1:4000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa Observed MW: 23kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=786

Uniprot URL

https://www.uniprot.org/uniprot/Q06432

AA Sequence

DHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-NLK antibody
STJ24772 100 µl

Anti-NLK antibody

Ask
View Details
Monocarboxylate Transporter 10 (SLC16A10) Human ELISA Kit
F0768 96 Tests

Monocarboxylate Transporter 10 (SLC16A10) Human ELISA Kit

Ask
View Details
CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (FITC)
C2399-07W-FITC 100 µL

CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (FITC)

Ask
View Details
POTE-8 (POTE Ankyrin Domain Family Member A, ANKRD26-like Family A Member 1, Prostate, Ovary, Testis-expressed Protein on Chromosome 8, POTE-8, POTEA, A26A1, POTE8) discontinued
330249-01 50 µg

POTE-8 (POTE Ankyrin Domain Family Member A, ANKRD26-like Family A Member 1, Prostate, Ovary, Testis-expressed Protein on Chromosome 8, POTE-8, POTEA, A26A1, POTE8) discontinued

Ask
View Details
POTE-8 (POTE Ankyrin Domain Family Member A, ANKRD26-like Family A Member 1, Prostate, Ovary, Testis-expressed Protein on Chromosome 8, POTE-8, POTEA, A26A1, POTE8) discontinued
330249-02 100 µg

POTE-8 (POTE Ankyrin Domain Family Member A, ANKRD26-like Family A Member 1, Prostate, Ovary, Testis-expressed Protein on Chromosome 8, POTE-8, POTEA, A26A1, POTE8) discontinued

Ask
View Details