Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUC16 Rabbit pAb (APR17639N)

Product Specifications

Background

This gene encodes a protein that is a member of the mucin family. Mucins are high molecular weight, O-glycosylated proteins that play an important role in forming a protective mucous barrier, and are found on the apical surfaces of the epithelia. The encoded protein is a membrane-tethered mucin that contains an extracellular domain at its amino terminus, a large tandem repeat domain, and a transmembrane domain with a short cytoplasmic domain. The amino terminus is highly glycosylated, while the repeat region contains 156 amino acid repeats unit that are rich in serines, threonines, and prolines. Interspersed within the repeats are Sea urchin sperm protein Enterokinase and Agrin (SEA) modules, leucine-rich repeats and ankyrin (ANK) repeats. These regions together form the ectodomain, and there is a potential cleavage site found near an SEA module close to the transmembrane domain. This protein is thought to play a role in forming a barrier, protecting epithelial cells from pathogens. Products of this gene have been used as a marker for different cancers, with higher expression levels associated with poorer outcomes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MUC16 Rabbit pAb (APR17639N) .

Synonyms

MUC16; CA125; mucin-16

Gene ID

94025

UniProt

Q8WXI7

Cellular Locus

Cell membrane, Secreted, Single-pass type I membrane protein, extracellular space

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 1519kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=94025

Uniprot URL

https://www.uniprot.org/uniprot/Q8WXI7

AA Sequence

QRSSLGARYTGCRVIALRSVKNGAETRVDLLCTYLQPLSGPGLPIKQVFHELSQQTHGITRLGPYSLDKDSLYLNGYNEPGPDEPPTTPKPATTFLPPLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vitamin D Binding protein (GC) (NM_000583) Human Recombinant Protein
TP308864L 1 mg

Vitamin D Binding protein (GC) (NM_000583) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: left
CP565787 150 µg

Tissue Protein Lysate, Ovary: left

Sign In for Pricing
View Details
BRG1 (SMARCA4) (NM_001128849) Human Over-expression Lysate
LC427007 20 µg

BRG1 (SMARCA4) (NM_001128849) Human Over-expression Lysate

Sign In for Pricing
View Details
Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3732), CF640R conjugate, 0.1mg/mL
BNC403732-500 1x 500 µL

Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3732), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NUDT17 Human Gene Knockout Kit (CRISPR)
KN419657 1 Kit

NUDT17 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TGFalpha (P/T1), CF640R conjugate, 0.1mg/mL
BNC400787-500 1x 500 µL

TGFalpha (P/T1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details