Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ID2 Rabbit pAb (APR17633N)

Product Specifications

Background

The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ID2 Rabbit pAb (APR17633N) .

Synonyms

ID2; GIG8; ID2A; ID2H; bHLHb26

Gene ID

3398

UniProt

Q02363

Cellular Locus

Cytoplasm, Nucleus

Applications

WB (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa Observed MW: 15kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3398

Uniprot URL

https://www.uniprot.org/uniprot/Q02363

AA Sequence

LQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Casein kinase IIα (E-7) Alexa Fluor® 680
sc-373894 AF680 200 µg/mL

Casein kinase IIα (E-7) Alexa Fluor® 680

Sign In for Pricing
View Details
SRC Protein (N-GST, Rous Sarcoma Virus)
P528743 100 µg

SRC Protein (N-GST, Rous Sarcoma Virus)

Sign In for Pricing
View Details
GPR52 Polyclonal Antibody
UB-GEN-13137 100 µL

GPR52 Polyclonal Antibody

Sign In for Pricing
View Details
Fmoc-D-Aph(Cbm)-OH
5-03843 250 mg

Fmoc-D-Aph(Cbm)-OH

Sign In for Pricing
View Details
Lentiviral human OXGR1 sgRNA gene knockout kit - Lentiviral human OXGR1 sgRNA gene knockout kit (25)
GTR15394158 1 Vial

Lentiviral human OXGR1 sgRNA gene knockout kit - Lentiviral human OXGR1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
NUDT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV705911 1.0 µg DNA

NUDT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details