Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclin H Rabbit pAb (APR17632N)

Product Specifications

Background

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1. The kinase complex is able to phosphorylate CDK2 and CDC2 kinases, thus functions as a CDK-activating kinase (CAK) . This cyclin and its kinase partner are components of TFIIH, as well as RNA polymerase II protein complexes. They participate in two different transcriptional regulation processes, suggesting an important link between basal transcription control and the cell cycle machinery. A pseudogene of this gene is found on chromosome 4. Alternate splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Cyclin H Rabbit pAb (APR17632N) .

Synonyms

CCNH; CAK; CycH; p34; p37; cyclin-H

Gene ID

902

UniProt

P51946

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=902

Uniprot URL

https://www.uniprot.org/uniprot/P51946

AA Sequence

MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PEF1, ID (PEF1, ABP32, Peflin, PEF protein with a long N-terminal hydrophobic domain, Penta-EF hand domain-containing protein 1) (MaxLight 650) discontinued
039869-ML650 100 µL

PEF1, ID (PEF1, ABP32, Peflin, PEF protein with a long N-terminal hydrophobic domain, Penta-EF hand domain-containing protein 1) (MaxLight 650) discontinued

Ask
View Details
Cy3-Linked Polyclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2047657-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Ask
View Details
Cy3-Linked Polyclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2047657-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Ask
View Details
Cy3-Linked Polyclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2047657-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Ask
View Details
Cy3-Linked Polyclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2047657-04 1 mL

Cy3-Linked Polyclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Ask
View Details
Cy3-Linked Polyclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2047657-05 5 mL

Cy3-Linked Polyclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Ask
View Details