Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] Hexokinase II Rabbit pAb (APR17631N)

Product Specifications

Background

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] Hexokinase II Rabbit pAb (APR17631N) .

Synonyms

HK2; HKII; HXK2; hexokinase-2

Gene ID

3099

UniProt

P52789

Cellular Locus

Mitochondrion outer membrane

Applications

WB (H460, unknow, SK-N-SH, U251, U87MG, Homo sapiens, Mus musculus, Rattus norvegicus) IHC (Mus musculus, Homo sapiens, Rattus norvegicus) IF (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 102kDa Observed MW: 102KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3099

Uniprot URL

https://www.uniprot.org/uniprot/P52789

AA Sequence

MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SBK2 activation kit by CRISPRa
GA118783 1 Kit

Human SBK2 activation kit by CRISPRa

Sign In for Pricing
View Details
(R)-3-((tert-Butoxycarbonyl)amino)-4-(2,4,5-trifluorophenyl)butanoic Acid
TRC-B692330-5G 5 g

(R)-3-((tert-Butoxycarbonyl)amino)-4-(2,4,5-trifluorophenyl)butanoic Acid

Sign In for Pricing
View Details
HP1 gamma (CBX3) (NM_007276) Human Recombinant Protein
TP760281 50 µg

HP1 gamma (CBX3) (NM_007276) Human Recombinant Protein

Sign In for Pricing
View Details
VILIP1 (VSNL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D5]
TA802088AM 100 µL

VILIP1 (VSNL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D5]

Sign In for Pricing
View Details
MHC Class I (RT1Ac) Mouse Monoclonal Antibody [Clone ID: OX-27]
CL129P 250 µg

MHC Class I (RT1Ac) Mouse Monoclonal Antibody [Clone ID: OX-27]

Sign In for Pricing
View Details
21-Dehydrocorticosterone Glycerol Acetal (Mixture of Diastereomers)
TRC-D282570-10MG 10 mg

21-Dehydrocorticosterone Glycerol Acetal (Mixture of Diastereomers)

Sign In for Pricing
View Details