Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NTF4 Rabbit pAb (APR17583N)

Product Specifications

Background

This gene is a member of a family of neurotrophic factors, neurotrophins, that control survival and differentiation of mammalian neurons. The expression of this gene is ubiquitous and less influenced by environmental signals. While knock-outs of other neurotrophins including nerve growth factor, brain-derived neurotrophic factor, and neurotrophin 3 prove lethal during early postnatal development, NTF5-deficient mice only show minor cellular deficits and develop normally to adulthood.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NTF4 Rabbit pAb (APR17583N) .

Synonyms

NTF4; GLC10; GLC1O; NT-4; NT-4/5; NT-5; NT4; NT5; NTF5

Gene ID

4909

UniProt

P34130

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4909

Uniprot URL

https://www.uniprot.org/uniprot/P34130

AA Sequence

QPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLFLLEAGAFRESAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCMAP Antibody
A57980-100UG 100 µg

NCMAP Antibody

Sign In for Pricing
View Details
Pbx 3 Double Nickase Plasmid (m)
sc-422125-NIC 20 µg

Pbx 3 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Fhl3 AAV siRNA Pooled Vector
20546166 1.0 µg

Fhl3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Jun D Rabbit pAb
E47R1393 100 µL

Jun D Rabbit pAb

Sign In for Pricing
View Details
pExpress-1-Efhd2 Plasmid
PVT40051 2 µg

pExpress-1-Efhd2 Plasmid

Sign In for Pricing
View Details
Ethyl 2- (chloromethyl) -4- (trifluoromethyl) -1,3-oxazole-5-carboxylate
DXC59050-01 50 mg

Ethyl 2- (chloromethyl) -4- (trifluoromethyl) -1,3-oxazole-5-carboxylate

Sign In for Pricing
View Details