Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF3 Rabbit pAb (APR17573N)

Product Specifications

Background

The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Several alternatively spliced transcript variants encoding three distinct isoforms have been reported.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TRAF3 Rabbit pAb (APR17573N) .

Synonyms

TRAF3; CAP-1; CAP1; CD40bp; CRAF1; IIAE5; LAP1

Gene ID

7187

UniProt

Q13114

Cellular Locus

Cytoplasm, Endosome, Mitochondrion

Dilution

WB 1:200 - 1:1000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa/64kDa Observed MW: 64kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7187

Uniprot URL

https://www.uniprot.org/uniprot/Q13114

AA Sequence

MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-INTS7
ARP83177_P050 100 µL

Anti-INTS7

Sign In for Pricing
View Details
Chicken Mitochondrial import receptor subunit TOM40 homolog (TOMM40) ELISA Kit
GTR10317917 96 Well

Chicken Mitochondrial import receptor subunit TOM40 homolog (TOMM40) ELISA Kit

Sign In for Pricing
View Details
Tfcp2l1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6275602 1.0 µg DNA

Tfcp2l1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
HOXB1 (Homeobox Protein Hox-B1, Homeobox Protein Hox-2I, HOX2I)
319403 100 µL

HOXB1 (Homeobox Protein Hox-B1, Homeobox Protein Hox-2I, HOX2I)

Sign In for Pricing
View Details
Iron Sulfate Hydrate
40600073-1 1 Kg

Iron Sulfate Hydrate

Sign In for Pricing
View Details
Olfr578 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4158605 3x 1.0 µg

Olfr578 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details