Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] NF2 Rabbit pAb (APR17542N)

Product Specifications

Background

This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that are thought to link cytoskeletal components with proteins in the cell membrane. This gene product has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics and proteins involved in regulating ion transport. This gene is expressed at high levels during embryonic development; in adults, significant expression is found in Schwann cells, meningeal cells, lens and nerve. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities. Two predominant isoforms and a number of minor isoforms are produced by alternatively spliced transcripts.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] NF2 Rabbit pAb (APR17542N) .

Synonyms

NF2; ACN; BANF; SCH; merlin

Gene ID

4771

UniProt

P35240

Cellular Locus

Cell projection, Cytoplasm, Cytoplasmic granule, Cytoplasmic side, Nucleus, Nucleus, Peripheral membrane protein, cytoskeleton, filopodium membrane, perinuclear region, ruffle membrane

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19-30kDa/59-72kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4771

Uniprot URL

https://www.uniprot.org/uniprot/P35240

AA Sequence

TKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNT

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mycobacterium tuberculosis Uncharacterized N-acetyltransferase Rv2669/MT2743 (Rv2669, MT2743)
MBS1147175-01 0.02 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Uncharacterized N-acetyltransferase Rv2669/MT2743 (Rv2669, MT2743)

Ask
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized N-acetyltransferase Rv2669/MT2743 (Rv2669, MT2743)
MBS1147175-02 0.1 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Uncharacterized N-acetyltransferase Rv2669/MT2743 (Rv2669, MT2743)

Ask
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized N-acetyltransferase Rv2669/MT2743 (Rv2669, MT2743)
MBS1147175-03 0.02 mg (Yeast)

Recombinant Mycobacterium tuberculosis Uncharacterized N-acetyltransferase Rv2669/MT2743 (Rv2669, MT2743)

Ask
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized N-acetyltransferase Rv2669/MT2743 (Rv2669, MT2743)
MBS1147175-04 0.1 mg (Yeast)

Recombinant Mycobacterium tuberculosis Uncharacterized N-acetyltransferase Rv2669/MT2743 (Rv2669, MT2743)

Ask
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized N-acetyltransferase Rv2669/MT2743 (Rv2669, MT2743)
MBS1147175-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium tuberculosis Uncharacterized N-acetyltransferase Rv2669/MT2743 (Rv2669, MT2743)

Ask
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized N-acetyltransferase Rv2669/MT2743 (Rv2669, MT2743)
MBS1147175-06 0.02 mg (Mammalian-Cell)

Recombinant Mycobacterium tuberculosis Uncharacterized N-acetyltransferase Rv2669/MT2743 (Rv2669, MT2743)

Ask
View Details