Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCTN3 Rabbit pAb (APR17515N)

Product Specifications

Background

This gene encodes a member of the tectonic gene family which functions in Hedgehog signal transduction and development of the neural tube. Mutations in this gene have been associated with Orofaciodigital Syndrome IV and Joubert Syndrom 18. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TCTN3 Rabbit pAb (APR17515N) .

Synonyms

TCTN3; C10orf61; JBTS18; OFD4; TECT3

Gene ID

26123

UniProt

Q6NUS6

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa/47kDa/50kDa/66kDa Observed MW: 68kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26123

Uniprot URL

https://www.uniprot.org/uniprot/Q6NUS6

AA Sequence

QTQSPPSFYRAGDPILTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLASSCTLDSALNAASYYNFTVLKVPRSMTDPQNMEFQVPVILTSQANAPLLAGNTCQNVVSQVTYEIETNGTFGIQKVSVSLGQTNLTVEPGASLQQHFILRFRAFQQSTAASLTSPRSGNPGYIVGKPLLALTDDISYSMTLLQSQGNGSCSVKRHEVQFGVNAISGCKLRLKKADCSHLQQEIYQTLHGRPRPEYVAIFGNADPAQKGGWTR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpl39 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K5002507 1.0 µg DNA

Rpl39 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Influenza A H5N1 (A/Bangladesh/207095/2008) Hemagglutinin/HA HEK293 Cell Lysate (WB positive control)
MBS8116227-01 0.3 mg

Influenza A H5N1 (A/Bangladesh/207095/2008) Hemagglutinin/HA HEK293 Cell Lysate (WB positive control)

Sign In for Pricing
View Details
Influenza A H5N1 (A/Bangladesh/207095/2008) Hemagglutinin/HA HEK293 Cell Lysate (WB positive control)
MBS8116227-02 5x 0.3 mg

Influenza A H5N1 (A/Bangladesh/207095/2008) Hemagglutinin/HA HEK293 Cell Lysate (WB positive control)

Sign In for Pricing
View Details
CF062, ID (C6orf62, XTP12, Uncharacterized protein C6orf62, HBV X-transactivated gene 12 protein, HBV XAg-transactivated protein 12)
MBS6010368-01 0.2 mL

CF062, ID (C6orf62, XTP12, Uncharacterized protein C6orf62, HBV X-transactivated gene 12 protein, HBV XAg-transactivated protein 12)

Sign In for Pricing
View Details
CF062, ID (C6orf62, XTP12, Uncharacterized protein C6orf62, HBV X-transactivated gene 12 protein, HBV XAg-transactivated protein 12)
MBS6010368-02 5x 0.2 mL

CF062, ID (C6orf62, XTP12, Uncharacterized protein C6orf62, HBV X-transactivated gene 12 protein, HBV XAg-transactivated protein 12)

Sign In for Pricing
View Details
Naginata ketone
MF-0037317-01 1 mg

Naginata ketone

Sign In for Pricing
View Details