Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] SOX2 Rabbit pAb (APR17476N)

Product Specifications

Background

This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] SOX2 Rabbit pAb (APR17476N) .

Synonyms

ANOP3; MCOPS3; SOX2; SRY-box 2

Gene ID

6657

UniProt

P48431

Cellular Locus

Nucleus

Applications

WB (mouse brain, Mus musculus, Homo sapiens) IHC (Homo sapiens, Mus musculus) IF (Homo sapiens, Gallus gallus) IP (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa Observed MW: 35KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6657

Uniprot URL

https://www.uniprot.org/uniprot/P48431

AA Sequence

MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNN4 Rabbit Polyclonal Antibody
E53P08930 100 µL

KCNN4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ZNF333 Pre-designed siRNA Set B
SI018756B 1 Each

Human ZNF333 Pre-designed siRNA Set B

Sign In for Pricing
View Details
3- (Propane-2-sulfonyl) benzoic acid
VAA88464-01 100 mg

3- (Propane-2-sulfonyl) benzoic acid

Sign In for Pricing
View Details
3- (Propane-2-sulfonyl) benzoic acid
VAA88464-02 1 g

3- (Propane-2-sulfonyl) benzoic acid

Sign In for Pricing
View Details
Naproxen Rabbit Polyclonal Antibody
AP33036PU-N 500 µL

Naproxen Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(2S,3aS,11aS,12aR,14aS, Z) -2- ((2- (4-isopropylthiazol-2-yl) -7-methoxy-8-methylquinolin-4-yl) oxy) -5-methyl-4,14-dioxo-1,2,3,3a,4,5,6,7,8,9,11a,12,12a,13,14,14a-hexadecahydrocyclopenta[c]cyclopropa[g][1,6]diazacyclotetradecine-12a-carboxylic acid
OR1075564 5 mg

(2S,3aS,11aS,12aR,14aS, Z) -2- ((2- (4-isopropylthiazol-2-yl) -7-methoxy-8-methylquinolin-4-yl) oxy) -5-methyl-4,14-dioxo-1,2,3,3a,4,5,6,7,8,9,11a,12,12a,13,14,14a-hexadecahydrocyclopenta[c]cyclopropa[g][1,6]diazacyclotetradecine-12a-carboxylic acid

Sign In for Pricing
View Details