Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP98 Rabbit pAb (APR17467N)

Product Specifications

Background

Nuclear pore complexes (NPCs) regulate the transport of macromolecules between the nucleus and cytoplasm, and are composed of many polypeptide subunits, many of which belong to the nucleoporin family. This gene belongs to the nucleoporin gene family and encodes a 186 kDa precursor protein that undergoes autoproteolytic cleavage to generate a 98 kDa nucleoporin and 96 kDa nucleoporin. The 98 kDa nucleoporin contains a Gly-Leu-Phe-Gly (GLGF) repeat domain and participates in many cellular processes, including nuclear import, nuclear export, mitotic progression, and regulation of gene expression. The 96 kDa nucleoporin is a scaffold component of the NPC. Proteolytic cleavage is important for targeting of the proteins to the NPC. Translocations between this gene and many other partner genes have been observed in different leukemias. Rearrangements typically result in chimeras with the N-terminal GLGF domain of this gene to the C-terminus of the partner gene. Alternative splicing results in multiple transcript variants encoding different isoforms, at least two of which are proteolytically processed. Some variants lack the region that encodes the 96 kDa nucleoporin.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NUP98 Rabbit pAb (APR17467N) .

Synonyms

NUP98; ADIR2; NUP196; NUP96

Gene ID

4928

UniProt

P52948

Cellular Locus

Nucleoplasmic side, Nucleus, Nucleus membrane, Peripheral membrane protein, nuclear pore complex

Dilution

WB 1:1000 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 96kDa/97kDa/186kDa/187kDa/195kDa/197kDa Observed MW: 105kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4928

Uniprot URL

https://www.uniprot.org/uniprot/P52948

AA Sequence

SKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPPQVEKKGQ

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Prom2 (NM_178047) Mouse Tagged ORF Clone
MR210819 10 µg

Prom2 (NM_178047) Mouse Tagged ORF Clone

Ask
View Details
Zfp143 AAV siRNA Pooled Vector
50854164 1.0 µg

Zfp143 AAV siRNA Pooled Vector

Ask
View Details
DPP1 (CTSC) (NM_001814) Human Tagged ORF Clone Lentiviral Particle
RC214863L4V 200 µL

DPP1 (CTSC) (NM_001814) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Human MKLN1 (NM_001145354) AAV Particle
RC227835A1V 250 µL

Human MKLN1 (NM_001145354) AAV Particle

Ask
View Details
Frozen Tissue Sections, Prostate
CS548953 5x 5 µm

Frozen Tissue Sections, Prostate

Ask
View Details