Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP98 Rabbit pAb (APR17467N)

Product Specifications

Background

Nuclear pore complexes (NPCs) regulate the transport of macromolecules between the nucleus and cytoplasm, and are composed of many polypeptide subunits, many of which belong to the nucleoporin family. This gene belongs to the nucleoporin gene family and encodes a 186 kDa precursor protein that undergoes autoproteolytic cleavage to generate a 98 kDa nucleoporin and 96 kDa nucleoporin. The 98 kDa nucleoporin contains a Gly-Leu-Phe-Gly (GLGF) repeat domain and participates in many cellular processes, including nuclear import, nuclear export, mitotic progression, and regulation of gene expression. The 96 kDa nucleoporin is a scaffold component of the NPC. Proteolytic cleavage is important for targeting of the proteins to the NPC. Translocations between this gene and many other partner genes have been observed in different leukemias. Rearrangements typically result in chimeras with the N-terminal GLGF domain of this gene to the C-terminus of the partner gene. Alternative splicing results in multiple transcript variants encoding different isoforms, at least two of which are proteolytically processed. Some variants lack the region that encodes the 96 kDa nucleoporin.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NUP98 Rabbit pAb (APR17467N) .

Synonyms

NUP98; ADIR2; NUP196; NUP96

Gene ID

4928

UniProt

P52948

Cellular Locus

Nucleoplasmic side, Nucleus, Nucleus membrane, Peripheral membrane protein, nuclear pore complex

Dilution

WB 1:1000 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 96kDa/97kDa/186kDa/187kDa/195kDa/197kDa Observed MW: 105kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4928

Uniprot URL

https://www.uniprot.org/uniprot/P52948

AA Sequence

SKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPPQVEKKGQ

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SLC5A7 antibody
MBS5302924-01 0.1 mL

SLC5A7 antibody

Ask
View Details
SLC5A7 antibody
MBS5302924-02 5x 0.1 mL

SLC5A7 antibody

Ask
View Details
ABCC13 (Putative ATP-Binding Cassette Sub-Family C Member 13, ABCC13, C21orf73, PRED6) (HRP) discontinued
302230-HRP 100 µL

ABCC13 (Putative ATP-Binding Cassette Sub-Family C Member 13, ABCC13, C21orf73, PRED6) (HRP) discontinued

Ask
View Details
Lentiviral mouse Strc shRNA (UAS) - Lentiviral mouse Strc shRNA (UAS, GFP) plasmid
GTR15165622 1 Vial

Lentiviral mouse Strc shRNA (UAS) - Lentiviral mouse Strc shRNA (UAS, GFP) plasmid

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)
MBS2081912-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)
MBS2081912-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)

Ask
View Details