Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSC2 Rabbit pAb (APR17458N)

Product Specifications

Background

Mutations in this gene lead to tuberous sclerosis complex. Its gene product is believed to be a tumor suppressor and is able to stimulate specific GTPases. The protein associates with hamartin in a cytosolic complex, possibly acting as a chaperone for hamartin. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TSC2 Rabbit pAb (APR17458N) .

Synonyms

LAM; PPP1R160; TSC4; TSC2; Tuberin; tuberin

Gene ID

7249

UniProt

P49815

Cellular Locus

Cytoplasm, Membrane, Peripheral membrane protein

Applications

WB (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/187-200kDa Observed MW: 200KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7249

Uniprot URL

https://www.uniprot.org/uniprot/P49815

AA Sequence

CRLPFRKDFVPFITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARPPKQGLNNSPPVKEFKESSAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSVAQADDSLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGELQSGPESSSSPGVHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVGALDVPASQFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STX8 Peptide - C-terminal region (AAP61124)
AAP61124-100UG 100 µg

STX8 Peptide - C-terminal region (AAP61124)

Sign In for Pricing
View Details
Mmu-miR-673-3p agomir
HY-R03488A-01 5 nmol

Mmu-miR-673-3p agomir

Sign In for Pricing
View Details
Mmu-miR-673-3p agomir
HY-R03488A-02 20 nmol

Mmu-miR-673-3p agomir

Sign In for Pricing
View Details
QSK Double Nickase Plasmid (h2)
sc-406729-NIC-2 20 µg

QSK Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
OsSPX3 Rabbit Polyclonal Antibody
E580425-A-SE 100 µL

OsSPX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chicken Calmodulin-like protein 4 (CALML4) ELISA Kit
MBS7203049-01 48 Well

Chicken Calmodulin-like protein 4 (CALML4) ELISA Kit

Sign In for Pricing
View Details