Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSC2 Rabbit pAb (APR17458N)

Product Specifications

Background

Mutations in this gene lead to tuberous sclerosis complex. Its gene product is believed to be a tumor suppressor and is able to stimulate specific GTPases. The protein associates with hamartin in a cytosolic complex, possibly acting as a chaperone for hamartin. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TSC2 Rabbit pAb (APR17458N) .

Synonyms

LAM; PPP1R160; TSC4; TSC2; Tuberin; tuberin

Gene ID

7249

UniProt

P49815

Cellular Locus

Cytoplasm, Membrane, Peripheral membrane protein

Applications

WB (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/187-200kDa Observed MW: 200KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7249

Uniprot URL

https://www.uniprot.org/uniprot/P49815

AA Sequence

CRLPFRKDFVPFITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARPPKQGLNNSPPVKEFKESSAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSVAQADDSLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGELQSGPESSSSPGVHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVGALDVPASQFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pinin (PNN) CytoSection
TS409069P5 25 Slides

Pinin (PNN) CytoSection

Sign In for Pricing
View Details
TMEM179 Lentiviral Activation Particles (h2)
sc-415763-LAC-2 200 µL

TMEM179 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Lysozyme Solution, 10mg/mL
21570003-1 1 mL

Lysozyme Solution, 10mg/mL

Sign In for Pricing
View Details
Free Estriol ELISA
GWB-BQK1C0 96 Well Plate

Free Estriol ELISA

Sign In for Pricing
View Details
Olfr710 3'UTR Luciferase Stable Cell Line
TU115448 1.0 mL

Olfr710 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
YTHDC1 Mouse Monoclonal Antibody
BF8444-01 100 µL

YTHDC1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details