Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFA Rabbit pAb (APR17421N)

Product Specifications

Background

This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TGFA Rabbit pAb (APR17421N) .

Synonyms

TGFA; TFGA

Gene ID

7039

UniProt

P01135

Cellular Locus

Cell membrane, Secreted, Single-pass type I membrane protein, extracellular space

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa/17kDa Observed MW: 15kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7039

Uniprot URL

https://www.uniprot.org/uniprot/P01135

AA Sequence

ENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sema3g sgRNA CRISPR Lentivector set (Rat)
K6080301 3x 1.0 µg

Sema3g sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Reference 2 Pack 3 100-1000uL; 0.5-5mL; 1-10mL pipettes
E4920000920 1 Each

Reference 2 Pack 3 100-1000uL; 0.5-5mL; 1-10mL pipettes

Sign In for Pricing
View Details
EHHADH (Peroxisomal Bifunctional Enzyme, PBE, PBFE, Enoyl-CoA Hydratase/3,2-trans-enoyl-CoA Isomerase, 3-hydroxyacyl-CoA Dehydrogenase, ECHD) (MaxLight 490)
126215-ML490 100 µL

EHHADH (Peroxisomal Bifunctional Enzyme, PBE, PBFE, Enoyl-CoA Hydratase/3,2-trans-enoyl-CoA Isomerase, 3-hydroxyacyl-CoA Dehydrogenase, ECHD) (MaxLight 490)

Sign In for Pricing
View Details
MEX3A Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2476103 100 µL

MEX3A Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Wet Sieving Kit 200mm
ZMWSKOCT200 1 Each

Wet Sieving Kit 200mm

Sign In for Pricing
View Details
Anti-ZNF311 Antibody
CTA3623-01 30 µL

Anti-ZNF311 Antibody

Sign In for Pricing
View Details