Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79a Rabbit pAb (APR17418N)

Product Specifications

Background

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig) . Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD79a Rabbit pAb (APR17418N) .

Synonyms

CD79A; IGA; MB-1; CD79a molecule; CD79a

Gene ID

973

UniProt

P11912

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Applications

IF (Sus scrofa)

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa/25kDa Observed MW: 40-50KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=973

Uniprot URL

https://www.uniprot.org/uniprot/P11912

AA Sequence

LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibitor rno-miR-664-1-5p AAV miRNA Vector
Amr3059600 500 ng

Inhibitor rno-miR-664-1-5p AAV miRNA Vector

Sign In for Pricing
View Details
DGAT2 Rabbit Polyclonal Antibody (Cy5)
orb2448756 100 µL

DGAT2 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Anti-GGCT Antibody Picoband® Fluoro647 Conjugated
A06488-2-Fluoro647 100 µg/Vial

Anti-GGCT Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
TMC5 3'UTR GFP Stable Cell Line
TU075679 1.0 mL

TMC5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human IL2RG Pre-designed siRNA Set A
SI007608A 1 Each

Human IL2RG Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral human RADIL shRNA (UAS) - Lentiviral human RADIL shRNA (UAS) (100)
GTR15136710 1 Vial

Lentiviral human RADIL shRNA (UAS) - Lentiviral human RADIL shRNA (UAS) (100)

Sign In for Pricing
View Details