Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESRα Rabbit pAb (APR17406N)

Product Specifications

Background

This gene encodes an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative promoter usage and alternative splicing result in dozens of transcript variants, but the full-length nature of many of these variants has not been determined.

Synonyms

ESR1; ER; ESR; ESRA; ESTRR; Era; NR3A1; ER alpha

Gene ID

2099

UniProt

P03372

Cellular Locus

Cell membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic side, Golgi apparatus, Nucleus, Peripheral membrane protein, Single-pass type I membrane protein

Applications

WB (Mus musculus, Homo sapiens)

Dilution

WB 1:1000 - 1:4000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa/47kDa/53kDa/66kDa Observed MW: 66KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ESRα Rabbit pAb (APR17406N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2099

Uniprot URL

https://www.uniprot.org/uniprot/P03372

AA Sequence

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCND

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MAGNETIC BEAD SEPARATION PLATE, 384 Well, Standard Plate, Flat Bottom, 425 Round Posts, 52 MGO, NdFeB Magnets, Red Anodized Aluminum Magnet Frame, 4 Sided Pellet Location, 3.1mm Post Diameter, Axial - North Poles Up Magnetic Orientation, Gripper Accessible, BioTek Plate Washer Compatible, Non-SLAS Footprint, No Registration Base
VP 771BT-G-4-2AZ 1 Each

MAGNETIC BEAD SEPARATION PLATE, 384 Well, Standard Plate, Flat Bottom, 425 Round Posts, 52 MGO, NdFeB Magnets, Red Anodized Aluminum Magnet Frame, 4 Sided Pellet Location, 3.1mm Post Diameter, Axial - North Poles Up Magnetic Orientation, Gripper Accessible, BioTek Plate Washer Compatible, Non-SLAS Footprint, No Registration Base

Ask
View Details
Mortality Factor 4 like 2 (MORF4L2) (NM_001142420) Human Untagged Clone
SC324885 10 µg

Mortality Factor 4 like 2 (MORF4L2) (NM_001142420) Human Untagged Clone

Ask
View Details
Mouse Monoclonal FCAR/CD89 Antibody (488032) [PerCP]
FAB3939C 0.1 mL

Mouse Monoclonal FCAR/CD89 Antibody (488032) [PerCP]

Ask
View Details