Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Caspase-9 Rabbit pAb (APR17393N)

Product Specifications

Background

This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein can undergo autoproteolytic processing and activation by the apoptosome, a protein complex of cytochrome c and the apoptotic peptidase activating factor 1; this step is thought to be one of the earliest in the caspase activation cascade. This protein is thought to play a central role in apoptosis and to be a tumor suppressor. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Caspase-9 Rabbit pAb (APR17393N) .

Synonyms

CASP9; APAF-3; APAF3; ICE-LAP6; MCH6; PPP1R56; caspase-9; casp9; Caspase 9

Gene ID

842

UniProt

P55211

Applications

WB (Homo sapiens, Sanghuangporus vaninii, Rattus norvegicus, Bos taurus, Mus musculus, crab)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/30kDa/36kDa/46kDa Observed MW: 35KDa/37KDa/47KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=842

Uniprot URL

https://www.uniprot.org/uniprot/P55211

AA Sequence

MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Uncharacterized protein C17orf47 (C17orf47)
MBS1295954-01 0.02 mg (E-Coli)

Recombinant Human Uncharacterized protein C17orf47 (C17orf47)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C17orf47 (C17orf47)
MBS1295954-02 0.02 mg (Yeast)

Recombinant Human Uncharacterized protein C17orf47 (C17orf47)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C17orf47 (C17orf47)
MBS1295954-03 0.1 mg (E-Coli)

Recombinant Human Uncharacterized protein C17orf47 (C17orf47)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C17orf47 (C17orf47)
MBS1295954-04 0.1 mg (Yeast)

Recombinant Human Uncharacterized protein C17orf47 (C17orf47)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C17orf47 (C17orf47)
MBS1295954-05 0.02 mg (Baculovirus)

Recombinant Human Uncharacterized protein C17orf47 (C17orf47)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C17orf47 (C17orf47)
MBS1295954-06 0.02 mg (Mammalian-Cell)

Recombinant Human Uncharacterized protein C17orf47 (C17orf47)

Sign In for Pricing
View Details