Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VCAM1 Rabbit pAb (APR17391N)

Product Specifications

Background

This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality VCAM1 Rabbit pAb (APR17391N) .

Synonyms

CD106; INCAM-100; VCAM1

Gene ID

7412

UniProt

P19320

Cellular Locus

Membrane, Single-pass type I membrane protein

Applications

WB (Homo sapiens, Rattus norvegicus, Mus musculus, Cynoglossus semilaevis) IHC (Mus musculus)

Dilution

WB 1:1000 - 1:3000 IHC 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 71kDa/74kDa/81kDa Observed MW: 100-120KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7412

Uniprot URL

https://www.uniprot.org/uniprot/P19320

AA Sequence

NRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVEL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KLF13 (Krueppel-like Factor 13, Basic Transcription Element-binding Protein 3, BTE-binding Protein 3, Novel Sp1-like Zinc Finger Transcription Factor 1, RANTES Factor of Late Activated T-lymphocytes 1, RFLAT-1, Transcription Factor BTEB3, Transcription Fa
MBS6400946-01 0.1 mL

KLF13 (Krueppel-like Factor 13, Basic Transcription Element-binding Protein 3, BTE-binding Protein 3, Novel Sp1-like Zinc Finger Transcription Factor 1, RANTES Factor of Late Activated T-lymphocytes 1, RFLAT-1, Transcription Factor BTEB3, Transcription Fa

Ask
View Details
KLF13 (Krueppel-like Factor 13, Basic Transcription Element-binding Protein 3, BTE-binding Protein 3, Novel Sp1-like Zinc Finger Transcription Factor 1, RANTES Factor of Late Activated T-lymphocytes 1, RFLAT-1, Transcription Factor BTEB3, Transcription Fa
MBS6400946-02 5x 0.1 mL

KLF13 (Krueppel-like Factor 13, Basic Transcription Element-binding Protein 3, BTE-binding Protein 3, Novel Sp1-like Zinc Finger Transcription Factor 1, RANTES Factor of Late Activated T-lymphocytes 1, RFLAT-1, Transcription Factor BTEB3, Transcription Fa

Ask
View Details
Anti-Sialic Acid Binding Ig Like Lectin 2 (CD22) Monoclonal Antibody
CAU35903-01 100 µL

Anti-Sialic Acid Binding Ig Like Lectin 2 (CD22) Monoclonal Antibody

Ask
View Details
Anti-Sialic Acid Binding Ig Like Lectin 2 (CD22) Monoclonal Antibody
CAU35903-02 200 µL

Anti-Sialic Acid Binding Ig Like Lectin 2 (CD22) Monoclonal Antibody

Ask
View Details
Anti-Sialic Acid Binding Ig Like Lectin 2 (CD22) Monoclonal Antibody
CAU35903-03 1 mL

Anti-Sialic Acid Binding Ig Like Lectin 2 (CD22) Monoclonal Antibody

Ask
View Details
MHC Class II (I-Ab,d) Mouse Monoclonal Antibody [Clone ID: 25-9-17S]
AM31877FC-N 100 µg

MHC Class II (I-Ab,d) Mouse Monoclonal Antibody [Clone ID: 25-9-17S]

Ask
View Details