Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RhoA Rabbit pAb (APR17386N)

Product Specifications

Background

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RhoA Rabbit pAb (APR17386N) .

Synonyms

ARH12; ARHA; RHO12; RHOH12; Rho; RHOA; RhoA

Gene ID

387

UniProt

P61586

Cellular Locus

Cell membrane, Cell projection, Cleavage furrow, Cytoplasm, Cytoplasmic side, Lipid-anchor, Midbody, cell cortex, cytoskeleton, lamellipodium

Applications

WB (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa Observed MW: 21KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=387

Uniprot URL

https://www.uniprot.org/uniprot/P61586

AA Sequence

TPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAT3 (BAG6) Human Gene Knockout Kit (CRISPR)
KN401122 1 Kit

BAT3 (BAG6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAM102A (NM_001035254) Human Over-expression Lysate
LY422128 100 µg

FAM102A (NM_001035254) Human Over-expression Lysate

Sign In for Pricing
View Details
CD27 Polyclonal Antibody
E-AB-14846-01 20 µL

CD27 Polyclonal Antibody

Sign In for Pricing
View Details
CD27 Polyclonal Antibody
E-AB-14846-02 60 µL

CD27 Polyclonal Antibody

Sign In for Pricing
View Details
CD27 Polyclonal Antibody
E-AB-14846-03 120 µL

CD27 Polyclonal Antibody

Sign In for Pricing
View Details
CD27 Polyclonal Antibody
E-AB-14846-04 200 µL

CD27 Polyclonal Antibody

Sign In for Pricing
View Details