Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RhoA Rabbit pAb (APR17386N)

Product Specifications

Background

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RhoA Rabbit pAb (APR17386N) .

Synonyms

ARH12; ARHA; RHO12; RHOH12; Rho; RHOA; RhoA

Gene ID

387

UniProt

P61586

Cellular Locus

Cell membrane, Cell projection, Cleavage furrow, Cytoplasm, Cytoplasmic side, Lipid-anchor, Midbody, cell cortex, cytoskeleton, lamellipodium

Applications

WB (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa Observed MW: 21KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=387

Uniprot URL

https://www.uniprot.org/uniprot/P61586

AA Sequence

TPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Myc (MYC275), CF594 conjugate, 0.1mg/mL
BNC940275-500 1x 500 µL

C-Myc (MYC275), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Angiopoietin-Related Protein 4/ANGPTL4 (N-6His)
PKSH033846-01 10 µg

Recombinant Human Angiopoietin-Related Protein 4/ANGPTL4 (N-6His)

Sign In for Pricing
View Details
Recombinant Human Angiopoietin-Related Protein 4/ANGPTL4 (N-6His)
PKSH033846-02 50 µg

Recombinant Human Angiopoietin-Related Protein 4/ANGPTL4 (N-6His)

Sign In for Pricing
View Details
IRE1 (ERN1) Human Gene Knockout Kit (CRISPR)
KN415023 1 Kit

IRE1 (ERN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-3), Biotin conjugate, 0.1mg/mL
BNCB2256-500 1x 500 µL

Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Tissue Factor/CD142 protein (His tag)
PDMH100094-01 20 µg

Recombinant Human Tissue Factor/CD142 protein (His tag)

Sign In for Pricing
View Details