Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIK3CG Rabbit pAb (APR17381N)

Product Specifications

Background

Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I catalytic subunit of PI3K. Like other class I catalytic subunits (p110-alpha p110-beta, and p110-delta), the encoded protein binds a p85 regulatory subunit to form PI3K. This gene is located in a commonly deleted segment of chromosome 7 previously identified in myeloid leukemias. Several transcript variants encoding the same protein have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PIK3CG Rabbit pAb (APR17381N) .

Synonyms

PIK3CG; PI3CG; PI3K; PI3Kgamma; PIK3; p110gamma; p120-PI3K

Gene ID

5294

UniProt

P48736

Cellular Locus

Cell membrane, Cytoplasm

Applications

WB (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 126kDa Observed MW: 126kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5294

Uniprot URL

https://www.uniprot.org/uniprot/P48736

AA Sequence

MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLDCLRYWKATHRSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HGF (Hepatocyte Growth Factor, SF, HGFB, HPTA, F-TCF, DFNB39) discontinued
211222-01 20 µL

HGF (Hepatocyte Growth Factor, SF, HGFB, HPTA, F-TCF, DFNB39) discontinued

Sign In for Pricing
View Details
HGF (Hepatocyte Growth Factor, SF, HGFB, HPTA, F-TCF, DFNB39) discontinued
211222-02 100 µL

HGF (Hepatocyte Growth Factor, SF, HGFB, HPTA, F-TCF, DFNB39) discontinued

Sign In for Pricing
View Details
May & Grunwald's Solution Modified For Microscopy
1640A 00125 125 mL

May & Grunwald's Solution Modified For Microscopy

Sign In for Pricing
View Details
Recombinant Human CD79B/B29 Protein
RP00565 10 µg

Recombinant Human CD79B/B29 Protein

Sign In for Pricing
View Details
Apolipoprotein E (APOE) DIY ELISA Kit
MBS2163237-01 5x 96 Tests

Apolipoprotein E (APOE) DIY ELISA Kit

Sign In for Pricing
View Details
Apolipoprotein E (APOE) DIY ELISA Kit
MBS2163237-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)

Apolipoprotein E (APOE) DIY ELISA Kit

Sign In for Pricing
View Details