Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIK3CG Rabbit pAb (APR17381N)

Product Specifications

Background

Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I catalytic subunit of PI3K. Like other class I catalytic subunits (p110-alpha p110-beta, and p110-delta), the encoded protein binds a p85 regulatory subunit to form PI3K. This gene is located in a commonly deleted segment of chromosome 7 previously identified in myeloid leukemias. Several transcript variants encoding the same protein have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PIK3CG Rabbit pAb (APR17381N) .

Synonyms

PIK3CG; PI3CG; PI3K; PI3Kgamma; PIK3; p110gamma; p120-PI3K

Gene ID

5294

UniProt

P48736

Cellular Locus

Cell membrane, Cytoplasm

Applications

WB (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 126kDa Observed MW: 126kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5294

Uniprot URL

https://www.uniprot.org/uniprot/P48736

AA Sequence

MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLDCLRYWKATHRSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-conjugated Anti-SOST (blosozumab biosimilar) mAb
MBS1881008-01 100 Tests

PE-conjugated Anti-SOST (blosozumab biosimilar) mAb

Sign In for Pricing
View Details
PE-conjugated Anti-SOST (blosozumab biosimilar) mAb
MBS1881008-02 5x 100 Tests

PE-conjugated Anti-SOST (blosozumab biosimilar) mAb

Sign In for Pricing
View Details
ST3GAL5 Protein Vector (Mouse) (pPM-C-HA)
45633025 500 ng

ST3GAL5 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TNFSF12 (Biotin)
579604-01 50 µg

TNFSF12 (Biotin)

Sign In for Pricing
View Details
TNFSF12 (Biotin)
579604-02 100 µg

TNFSF12 (Biotin)

Sign In for Pricing
View Details
LIM domain only 3 (LMO3) (NM_001243612) Human Untagged Clone
SC330153 10 µg

LIM domain only 3 (LMO3) (NM_001243612) Human Untagged Clone

Sign In for Pricing
View Details