Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C-Jun Rabbit pAb (APR17367N)

Product Specifications

Background

This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality c-Jun Rabbit pAb (APR17367N) .

Synonyms

AP-1; AP1; c-Jun; JUN; c

Gene ID

3725

UniProt

P05412

Cellular Locus

Nucleus

Applications

WB (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa Observed MW: 46kDa/42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3725

Uniprot URL

https://www.uniprot.org/uniprot/P05412

AA Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MHC Class I Polypeptide Related Sequence B (MICB)
RPU58370-01 50 µg

Recombinant Human MHC Class I Polypeptide Related Sequence B (MICB)

Sign In for Pricing
View Details
Recombinant Human MHC Class I Polypeptide Related Sequence B (MICB)
RPU58370-02 100 µg

Recombinant Human MHC Class I Polypeptide Related Sequence B (MICB)

Sign In for Pricing
View Details
Recombinant Human MHC Class I Polypeptide Related Sequence B (MICB)
RPU58370-03 1 mg

Recombinant Human MHC Class I Polypeptide Related Sequence B (MICB)

Sign In for Pricing
View Details
THSD7A (NM_015204) Human Tagged Lenti ORF Clone
RC213616L2 10 µg

THSD7A (NM_015204) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ccdc80 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
15312116 3x 1.0 µg

Ccdc80 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Viral VACWR090 protein
orb54723-01 20 µg

Viral VACWR090 protein

Sign In for Pricing
View Details