Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C-Jun Rabbit pAb (APR17367N)

Product Specifications

Background

This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality c-Jun Rabbit pAb (APR17367N) .

Synonyms

AP-1; AP1; c-Jun; JUN; c

Gene ID

3725

UniProt

P05412

Cellular Locus

Nucleus

Applications

WB (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa Observed MW: 46kDa/42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3725

Uniprot URL

https://www.uniprot.org/uniprot/P05412

AA Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mier1 (NM_001131012) Rat Tagged Lenti ORF Clone
RR210572L4 10 µg

Mier1 (NM_001131012) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TTTY13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2555408 1.0 µg DNA

TTTY13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal GST Epitope Tag Antibody [DyLight 594]
NBP2-37820DL594 0.1 mL

Rabbit Polyclonal GST Epitope Tag Antibody [DyLight 594]

Sign In for Pricing
View Details
ZNF420-set siRNA/shRNA/RNAi Lentivector (Human)
51510091 4x 500 ng

ZNF420-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
BRD9 (NM_001009877) Human 3' UTR Clone
SC209411 10 µg

BRD9 (NM_001009877) Human 3' UTR Clone

Sign In for Pricing
View Details
Leptin receptor Polyclonal Antibody, APC-Cy7 Conjugated
bs-0410R-APC-Cy7 100 µL

Leptin receptor Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details