Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BiP/GRP78 Rabbit pAb (APR17362N)

Product Specifications

Background

The protein encoded by this gene is a member of the heat shock protein 70 (HSP70) family. It is localized in the lumen of the endoplasmic reticulum (ER), and is involved in the folding and assembly of proteins in the ER. As this protein interacts with many ER proteins, it may play a key role in monitoring protein transport through the cell.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BiP/GRP78 Rabbit pAb (APR17362N) .

Synonyms

HSPA5; BIP; GRP78; HEL-S-89n; MIF2

Gene ID

3309

UniProt

P11021

Cellular Locus

Cytoplasm, Endoplasmic reticulum lumen, Melanosome

Applications

WB (RAW264.7, Rat spinal cord, Mouse marrow, Homo sapiens, Mus musculus, Panax notoginseng (Burk.) F. H. Chen , Rattus norvegicus) IF (Homo sapiens, Panax notoginseng (Burk.) F. H. Chen) IHC (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 72kDa Observed MW: 78KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3309

Uniprot URL

https://www.uniprot.org/uniprot/P11021

AA Sequence

EEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLA2G4A Antibody (Biotin)
orb46042-01 50 µg

PLA2G4A Antibody (Biotin)

Sign In for Pricing
View Details
PLA2G4A Antibody (Biotin)
orb46042-02 100 µg

PLA2G4A Antibody (Biotin)

Sign In for Pricing
View Details
APC human CD16 Antibody
orb3066453-01 25 Tests

APC human CD16 Antibody

Sign In for Pricing
View Details
APC human CD16 Antibody
orb3066453-02 100 Tests

APC human CD16 Antibody

Sign In for Pricing
View Details
P-c-Jun (KM-1)
sc-822 200 µg/mL

P-c-Jun (KM-1)

Sign In for Pricing
View Details
Lentiviral human USE1 shRNA (UAS) - Lentiviral human USE1 shRNA (UAS, GFP) (25)
GTR15353435 1 Vial

Lentiviral human USE1 shRNA (UAS) - Lentiviral human USE1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details