Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BiP/GRP78 Rabbit pAb (APR17362N)

Product Specifications

Background

The protein encoded by this gene is a member of the heat shock protein 70 (HSP70) family. It is localized in the lumen of the endoplasmic reticulum (ER), and is involved in the folding and assembly of proteins in the ER. As this protein interacts with many ER proteins, it may play a key role in monitoring protein transport through the cell.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BiP/GRP78 Rabbit pAb (APR17362N) .

Synonyms

HSPA5; BIP; GRP78; HEL-S-89n; MIF2

Gene ID

3309

UniProt

P11021

Cellular Locus

Cytoplasm, Endoplasmic reticulum lumen, Melanosome

Applications

WB (RAW264.7, Rat spinal cord, Mouse marrow, Homo sapiens, Mus musculus, Panax notoginseng (Burk.) F. H. Chen , Rattus norvegicus) IF (Homo sapiens, Panax notoginseng (Burk.) F. H. Chen) IHC (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 72kDa Observed MW: 78KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3309

Uniprot URL

https://www.uniprot.org/uniprot/P11021

AA Sequence

EEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

20μL Filter Pipette Tips, Non-Sterile, 1000pcs*10bags/Carton
21081203 10000 PCS

20μL Filter Pipette Tips, Non-Sterile, 1000pcs*10bags/Carton

Sign In for Pricing
View Details
Olr211 3'UTR Lenti-reporter-Luc Vector
34227086 1.0 µg

Olr211 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Olr916 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7420508 1.0 µg DNA

Olr916 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
KRT8 Antibody : FITC (OAAF00638-FITC)
OAAF00638-100UG-FITC 100 µg

KRT8 Antibody : FITC (OAAF00638-FITC)

Sign In for Pricing
View Details
Lgr5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6160707 1.0 µg DNA

Lgr5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
FRS2 Cell-Based ELISA Kit
CB5278 1 Kit

FRS2 Cell-Based ELISA Kit

Sign In for Pricing
View Details