Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Caspase-3 Rabbit pAb (APR17340N)

Product Specifications

Background

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Caspase-3 Rabbit pAb (APR17340N) .

Synonyms

CPP32; CPP32B; SCA-1; Active Caspase 3; CASP3; active Caspase-3; Caspase 3; Caspase-3 p12; caspase-3

Gene ID

836

UniProt

P42574

Cellular Locus

Cytoplasm

Applications

WB (Eoma cell, U2OS, Saos-2, Rattus norvegicus, Homo sapiens, Mus musculus, Apocynum venetum leaf, Gallus gallus, Sus scrofa, crab) IHC (Eoma cell, Mus musculus) IF (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa Observed MW: 32KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=836

Uniprot URL

https://www.uniprot.org/uniprot/P42574

AA Sequence

MRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Thrombin/Antithrombin Complex (TAT) ELISA Kit
abx256034-01 96 Tests

Rat Thrombin/Antithrombin Complex (TAT) ELISA Kit

Sign In for Pricing
View Details
Rat Thrombin/Antithrombin Complex (TAT) ELISA Kit
abx256034-02 5x 96 Tests

Rat Thrombin/Antithrombin Complex (TAT) ELISA Kit

Sign In for Pricing
View Details
Rat Thrombin/Antithrombin Complex (TAT) ELISA Kit
abx256034-03 10x 96 Tests

Rat Thrombin/Antithrombin Complex (TAT) ELISA Kit

Sign In for Pricing
View Details
Mouse Acid Phosphatase (ACP) ELISA Kit
GA-E0238MS-01 48 Tests

Mouse Acid Phosphatase (ACP) ELISA Kit

Sign In for Pricing
View Details
Mouse Acid Phosphatase (ACP) ELISA Kit
GA-E0238MS-02 96 Tests

Mouse Acid Phosphatase (ACP) ELISA Kit

Sign In for Pricing
View Details
Human desmin (Des) ELISA Kit
201-12-1233 96 Tests

Human desmin (Des) ELISA Kit

Sign In for Pricing
View Details