Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-Fetoprotein (AFP) Rabbit pAb (APR17327N)

Product Specifications

Background

This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Alpha-Fetoprotein (AFP) Rabbit pAb (APR17327N) .

Synonyms

AFPD; FETA; HPAFP; AFP

Gene ID

174

UniProt

P02771

Cellular Locus

Secreted

Applications

IHC (Murine liver, Mus musculus) IF (Mus musculus, Homo sapiens) WB (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 68kDa Observed MW: 68kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=174

Uniprot URL

https://www.uniprot.org/uniprot/P02771

AA Sequence

RRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Integrin alpha 4 Rabbit pAb
GB11652 100 μL

Anti-Integrin alpha 4 Rabbit pAb

Sign In for Pricing
View Details
Rem2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3741103 1.0 µg DNA

Rem2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
SETD3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
43523124 3x 1.0µg DNA

SETD3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
BBS7, NT (BBS7, BBS2L1, Bardet-Biedl syndrome 7 protein, BBS2-like protein 1) (MaxLight 550)
MBS6277742-01 0.1 mL

BBS7, NT (BBS7, BBS2L1, Bardet-Biedl syndrome 7 protein, BBS2-like protein 1) (MaxLight 550)

Sign In for Pricing
View Details
BBS7, NT (BBS7, BBS2L1, Bardet-Biedl syndrome 7 protein, BBS2-like protein 1) (MaxLight 550)
MBS6277742-02 5x 0.1 mL

BBS7, NT (BBS7, BBS2L1, Bardet-Biedl syndrome 7 protein, BBS2-like protein 1) (MaxLight 550)

Sign In for Pricing
View Details
SNAP25 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV696885 1.0 µg DNA

SNAP25 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details