Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse anti GST-Tag mAb (AMM22045N)

Product Specifications

Background

Glutathione S-transferases (GSTs), previously known as ligandins, comprise a family of eukaryotic and prokaryotic phase II metabolic isozymes best known for their ability to catalyze the conjugation of the reduced form of glutathione (GSH) to xenobiotic substrates for the purpose of detoxification. The GST family consists of three superfamilies: the cytosolic, mitochondrial, and microsomal—also known as MAPEG—proteins. Members of the GST superfamily are extremely diverse in amino acid sequence, and a large fraction of the sequences deposited in public databases are of unknown function. The Enzyme Function Initiative (EFI) is using GSTs as a model superfamily to identify new GST functions.A GST-tag is often used to separate and purify proteins that contain the GST-fusion protein. The tag is 220 amino acids (roughly 26 KDa) in size, which, compared to tags such as the Myc-tag or the FLAG-tag, is quite large. It can be fused to either the N-terminus or C-terminus of a protein. However, many commercially available sources of GST-tagged plasmids include a thrombin domain for cleavage of the GST tag during protein purification.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Mouse anti GST-Tag mAb (AMM22045N) .

Synonyms

GST; GST tag; GST-tag

Applications

WB (Nicotiana benthamiana, Homo sapiens, Arabidopsis thaliana, Other, Mus musculus, Oryza sativa, Yeast, Ctenopharyngodon idellus, Gallus gallus) IP (Mus musculus, Other, Ctenopharyngodon idellus) Co-IP (Ctenopharyngodon idellus, Other) ELISA (Mus musculus, Rattus norvegicus, Oyster) IF (Mus musculus, Rattus norvegicus, Oyster)

Dilution

WB 1:2000 - 1:5000 IP 1:20 - 1:50

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa Observed MW: 27kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

AA Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MtTF1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61684R-BF555-01 20 µL

MtTF1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
MtTF1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61684R-BF555-02 100 µL

MtTF1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
DNA-PK Antibody
3130-100 100 µg

DNA-PK Antibody

Sign In for Pricing
View Details
Rat Monoclonal GM-CSF Antibody (BVD2-21C11) [Alexa Fluor 647]
NBP2-34570AF647 0.1 mL

Rat Monoclonal GM-CSF Antibody (BVD2-21C11) [Alexa Fluor 647]

Sign In for Pricing
View Details
POU6F1 (BRN5, MPOU, TCFB1, POU Domain, Class 6, Transcription Factor 1, Brain-specific Homeobox/POU Domain Protein 5, mPOU Homeobox Protein) (MaxLight 490)
131633-ML490 100 µL

POU6F1 (BRN5, MPOU, TCFB1, POU Domain, Class 6, Transcription Factor 1, Brain-specific Homeobox/POU Domain Protein 5, mPOU Homeobox Protein) (MaxLight 490)

Sign In for Pricing
View Details
RNU5F-3P Protein Vector (Human) (pPB-C-His)
PV118662 500 ng

RNU5F-3P Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details