Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IdeS, Streptococcus pyogenes (His)

IdeS Protein is a highly specific IgG endopeptidase evolved from Streptococcus pyogenes, which can degrade IgG and participate in the immune response. IdeS Protein inhibits the function of certain neutrophil effectors, namely the production of reactive oxygen species (ROS), independently of IgG endopeptidase activity. IdeS Protein, Streptococcus pyogenes (His) is the recombinant IdeS protein, expressed by E. coli , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

IdeS Protein, Streptococcus pyogenes (His), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ides-protein-streptococcus-pyogenes-n-his.html

Purity

95.00

Smiles

DSFSANQEIRYSEVTPYHVTSVWTKGVTPPAKFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLCGAATAGNMLHWWFDQNKEKIEAYLKKHPDKQKIMFGDQELLDVRKVINTKGDQTNSELFNYFRDKAFPGLSARRIGVMPDLVLDMFINGYYLNVYKTQTTDVNRTYQEKDRRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQTN

Molecular Formula

/ (Gene_ID) F8V4V0 (D30-N341) (Accession)

Molecular Weight

Approximately 34 kDa

References & Citations

[1]von Pawel-Rammingen U. Streptococcal IdeS and its impact on immune response and inflammation. J Innate Immun. 2012;4 (2) :132-40.|[2]Shin JI, et al. Anti-glomerular basement membrane disease (Goodpasture disease) : From pathogenesis to plasma exchange to IdeS. Ther Apher Dial. 2022 Feb;26 (1) :24-31.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF589 Peptide - C-terminal region (AAP32663)
AAP32663-100UG 100 µg

ZNF589 Peptide - C-terminal region (AAP32663)

Sign In for Pricing
View Details
Lentiviral mouse Srcin1 shRNA (UAS) - Lentiviral mouse Srcin1 shRNA (UAS, iRFP) plasmid
GTR15216412 1 Vial

Lentiviral mouse Srcin1 shRNA (UAS) - Lentiviral mouse Srcin1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Nori® Monkey IgE ELISA Kit
GR169319 96 Well

Nori® Monkey IgE ELISA Kit

Sign In for Pricing
View Details
Rabbit SPTBN2/SCA5 Antibody
orb1528994-01 10 µL

Rabbit SPTBN2/SCA5 Antibody

Sign In for Pricing
View Details
Rabbit SPTBN2/SCA5 Antibody
orb1528994-02 100 µL

Rabbit SPTBN2/SCA5 Antibody

Sign In for Pricing
View Details
Lentiviral human RAB40AL sgRNA gene knockout kit - Lentiviral human RAB40AL sgRNA gene knockout kit (plasmid)
GTR15369875 1 Vial

Lentiviral human RAB40AL sgRNA gene knockout kit - Lentiviral human RAB40AL sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details