Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACBD7, Human (His)

ACBD7 Protein, pivotal in cellular metabolism, exhibits specific binding to medium- and long-chain acyl-CoA esters, hinting at a role as a molecular carrier for intracellular transport. This unique capability suggests ACBD7's involvement in regulating lipid metabolism, emphasizing its potential impact on cellular processes related to lipid homeostasis and energy metabolism. ACBD7 Protein, Human (His) is the recombinant human-derived ACBD7 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

ACBD7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acbd7-protein-human-his.html

Purity

98.0

Smiles

MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI

Molecular Formula

414149 (Gene_ID) Q8N6N7 (M1-I88) (Accession)

Molecular Weight

Approximately 10 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kdf1 Mouse Gene Knockout Kit (CRISPR)
KN500187 1 Kit

Kdf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Artery: peripheral
CR562657 5 µg

Tissue Total RNA, Artery: peripheral

Sign In for Pricing
View Details
Ɑ-Azido-ω-Amino PEG
135000-20-5.500MG 500 mg

Ɑ-Azido-ω-Amino PEG

Sign In for Pricing
View Details
Human WFDC13 activation kit by CRISPRa
GA116108 1 Kit

Human WFDC13 activation kit by CRISPRa

Sign In for Pricing
View Details
4-Ethynylpyridine Hydrochloride (>85%)
TRC-B124843-500MG 500 mg

4-Ethynylpyridine Hydrochloride (>85%)

Sign In for Pricing
View Details
b-Sinensal
TRC-S487310-25MG 25 mg

b-Sinensal

Sign In for Pricing
View Details