Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACBD7, Human (His)

ACBD7 Protein, pivotal in cellular metabolism, exhibits specific binding to medium- and long-chain acyl-CoA esters, hinting at a role as a molecular carrier for intracellular transport. This unique capability suggests ACBD7's involvement in regulating lipid metabolism, emphasizing its potential impact on cellular processes related to lipid homeostasis and energy metabolism. ACBD7 Protein, Human (His) is the recombinant human-derived ACBD7 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

ACBD7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acbd7-protein-human-his.html

Purity

98.0

Smiles

MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI

Molecular Formula

414149 (Gene_ID) Q8N6N7 (M1-I88) (Accession)

Molecular Weight

Approximately 10 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Propidium Iodide, 1 mg/mL solution in water
#40017 1x 10 mL

Propidium Iodide, 1 mg/mL solution in water

Sign In for Pricing
View Details
Human TMC5 activation kit by CRISPRa
GA112666 1 Kit

Human TMC5 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human PCSK9 Protein (AVI Tag)
PKSH032946-01 20 µg

Recombinant Human PCSK9 Protein (AVI Tag)

Sign In for Pricing
View Details
Recombinant Human PCSK9 Protein (AVI Tag)
PKSH032946-02 100 µg

Recombinant Human PCSK9 Protein (AVI Tag)

Sign In for Pricing
View Details
Her2 (ERBB2) (NM_004448) Human Recombinant Protein
TP710036 20 µg

Her2 (ERBB2) (NM_004448) Human Recombinant Protein

Sign In for Pricing
View Details
Human NKAIN2 activation kit by CRISPRa
GA115889 1 Kit

Human NKAIN2 activation kit by CRISPRa

Sign In for Pricing
View Details