Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACBD7, Human (His)

ACBD7 Protein, pivotal in cellular metabolism, exhibits specific binding to medium- and long-chain acyl-CoA esters, hinting at a role as a molecular carrier for intracellular transport. This unique capability suggests ACBD7's involvement in regulating lipid metabolism, emphasizing its potential impact on cellular processes related to lipid homeostasis and energy metabolism. ACBD7 Protein, Human (His) is the recombinant human-derived ACBD7 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

ACBD7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acbd7-protein-human-his.html

Purity

98.0

Smiles

MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI

Molecular Formula

414149 (Gene_ID) Q8N6N7 (M1-I88) (Accession)

Molecular Weight

Approximately 10 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sprint™ 6H Portable kit, 115V
C5000-6H-PT 1 Each

Sprint™ 6H Portable kit, 115V

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(3-Azidopropyl)triphenylphosphonium Bromide
TRC-A922790-250MG 250 mg

(3-Azidopropyl)triphenylphosphonium Bromide

Sign In for Pricing
View Details
ProPette REACH™ Long Neck Pipette Controller
P6950-I 1 Each

ProPette REACH™ Long Neck Pipette Controller

Sign In for Pricing
View Details
Recombinant Human CAMK1D Protein (GST Tag)
PKSH033740-01 10 µg

Recombinant Human CAMK1D Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human CAMK1D Protein (GST Tag)
PKSH033740-02 50 µg

Recombinant Human CAMK1D Protein (GST Tag)

Sign In for Pricing
View Details