Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VacA, Helicobacter pylori (His)

The VacA protein takes center stage, demonstrating its unique ability to induce vacuole formation in eukaryotic cells, affecting cell morphology. This process involves the formation of vacuoles, highlighting the role of VacA as a key regulator of cell structure. vacA Protein, Helicobacter pylori (His) is the recombinant vacA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

VacA Protein, Helicobacter pylori (His), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vaca-protein-helicobacter-pylori-his.html

Purity

98.0

Smiles

TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN

Molecular Formula

/ (Gene_ID) P55981 (T37-N245) (Accession)

Molecular Weight

Approximately 25-26.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human F3/TF (Tissue Factor) ELISA Kit
E-EL-H0040-01 24 Tests

Human F3/TF (Tissue Factor) ELISA Kit

Sign In for Pricing
View Details
Human F3/TF (Tissue Factor) ELISA Kit
E-EL-H0040-02 48 Tests

Human F3/TF (Tissue Factor) ELISA Kit

Sign In for Pricing
View Details
Human F3/TF (Tissue Factor) ELISA Kit
E-EL-H0040-03 96 Tests

Human F3/TF (Tissue Factor) ELISA Kit

Sign In for Pricing
View Details
Autosampler for TOC Analyzer BANA-609
BANA-609 Each

Autosampler for TOC Analyzer BANA-609

Sign In for Pricing
View Details
MCH2 (MCHR2) Rabbit Polyclonal Antibody
AP01217PU-N 100 µg

MCH2 (MCHR2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: 9H8G6]
AM06287SU-N 100 µL

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: 9H8G6]

Sign In for Pricing
View Details