Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VacA, Helicobacter pylori (His)

The VacA protein takes center stage, demonstrating its unique ability to induce vacuole formation in eukaryotic cells, affecting cell morphology. This process involves the formation of vacuoles, highlighting the role of VacA as a key regulator of cell structure. vacA Protein, Helicobacter pylori (His) is the recombinant vacA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

VacA Protein, Helicobacter pylori (His), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vaca-protein-helicobacter-pylori-his.html

Purity

98.0

Smiles

TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN

Molecular Formula

/ (Gene_ID) P55981 (T37-N245) (Accession)

Molecular Weight

Approximately 25-26.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP1 (Colorectal and Lymph Node Metastasis Marker) (TIMP1/1944R), CF647 conjugate, 0.1mg/mL
BNC471944-100 1x 100 µL

TIMP1 (Colorectal and Lymph Node Metastasis Marker) (TIMP1/1944R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rpl11 Mouse Gene Knockout Kit (CRISPR)
KN515014 1 Kit

Rpl11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Climatic Chamber BCCL-1407
BCCL-1407 1 Unit

Climatic Chamber BCCL-1407

Sign In for Pricing
View Details
Lusvertikimab Biosimilar - Research Grade
ICH5183-1mg 1 mg

Lusvertikimab Biosimilar - Research Grade

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3106), CF405S conjugate, 0.1mg/mL
BNC043106-500 1x 500 µL

TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details