Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VacA, Helicobacter pylori (His)

The VacA protein takes center stage, demonstrating its unique ability to induce vacuole formation in eukaryotic cells, affecting cell morphology. This process involves the formation of vacuoles, highlighting the role of VacA as a key regulator of cell structure. vacA Protein, Helicobacter pylori (His) is the recombinant vacA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

VacA Protein, Helicobacter pylori (His), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vaca-protein-helicobacter-pylori-his.html

Purity

98.0

Smiles

TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN

Molecular Formula

/ (Gene_ID) P55981 (T37-N245) (Accession)

Molecular Weight

Approximately 25-26.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC2B (NR_002166) Human Over-expression Lysate
LY403766 100 µg

TRAPPC2B (NR_002166) Human Over-expression Lysate

Sign In for Pricing
View Details
CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2763), CF640R conjugate, 0.1mg/mL
BNC402763-500 1x 500 µL

CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2763), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MIPEP Antibody
F40233-0.4ML 0.4 mL

MIPEP Antibody

Sign In for Pricing
View Details
Human F3/TF (Tissue Factor) ELISA Kit
E-EL-H0040-01 24 Tests

Human F3/TF (Tissue Factor) ELISA Kit

Sign In for Pricing
View Details
Human F3/TF (Tissue Factor) ELISA Kit
E-EL-H0040-02 48 Tests

Human F3/TF (Tissue Factor) ELISA Kit

Sign In for Pricing
View Details
Human F3/TF (Tissue Factor) ELISA Kit
E-EL-H0040-03 96 Tests

Human F3/TF (Tissue Factor) ELISA Kit

Sign In for Pricing
View Details